EIF4A1 anticorps (Middle Region)

N° du produit ABIN633087

Détail du produit anti-EIF4A1 anticorps

Antigène: EIF4A1 (Eukaryotic Translation Initiation Factor 4A1 (EIF4A1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF4A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF4 A1 antibody was raised against the middle region of EIF4 1

Purification: Affinity purified

Immunogène: EIF4 A1 antibody was raised using the middle region of EIF4 1 corresponding to a region with amino acids TMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF4A1 Blocking Peptide, catalog no. 33R-9207, is also available for use as a blocking control in assays to test for specificity of this EIF4A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF4A1

Antigène: EIF4A1 (Eukaryotic Translation Initiation Factor 4A1 (EIF4A1))

Autre désignation: EIF4A1 (EIF4A1 Produits)

Synonymes: anticorps DDX2A, anticorps EIF-4A, anticorps EIF4A, anticorps eIF-4A-I, anticorps eIF4A-I, anticorps BM-010, anticorps Ddx2a, anticorps Eif4, anticorps ddx2a, anticorps eif-4a, anticorps eif4a, anticorps eif4a1, anticorps fb49a04, anticorps im:7143023, anticorps wu:fb20a10, anticorps wu:fb49a04, anticorps wu:fc76a02, anticorps wu:fc96c01, anticorps wu:fd15g03, anticorps eukaryotic translation initiation factor 4A1, anticorps eukaryotic translation initiation factor 4A1 L homeolog, anticorps eukaryotic initiation factor 4A-I, anticorps eukaryotic translation initiation factor 4A1A, anticorps EIF4A1, anticorps Eif4a1, anticorps eif4a1.L, anticorps eif4a1, anticorps LOC695050, anticorps eif4a1a

Sujet: EIF4A1 is an ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.

Poids moléculaire: 46 kDa (MW of target protein)