ATP8B2 anticorps (N-Term)
-
- Antigène Voir toutes ATP8B2 Anticorps
- ATP8B2 (ATPase, Aminophospholipid Transporter, Class I, Type 8B, Member 2 (ATP8B2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATP8B2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ATP8 B2 antibody was raised against the N terminal of ATP8 2
- Purification
- Affinity purified
- Immunogène
- ATP8 B2 antibody was raised using the N terminal of ATP8 2 corresponding to a region with amino acids MAVCAKKRPPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLF
- Top Product
- Discover our top product ATP8B2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ATP8B2 Blocking Peptide, catalog no. 33R-5795, is also available for use as a blocking control in assays to test for specificity of this ATP8B2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ATP8B2 (ATPase, Aminophospholipid Transporter, Class I, Type 8B, Member 2 (ATP8B2))
- Autre désignation
- ATP8B2 (ATP8B2 Produits)
- Synonymes
- anticorps Id, anticorps ATPID, anticorps fc09b04, anticorps wu:fc09b04, anticorps ATPase, class I, type 8B, member 2, anticorps ATPase phospholipid transporting 8B2, anticorps ATPase, aminophospholipid transporter, class I, type 8B, member 2, anticorps Atp8b2, anticorps ATP8B2, anticorps atp8b2
- Sujet
- The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Poids moléculaire
- 44 kDa (MW of target protein)
-