ATP8B2 anticorps (N-Term)

N° du produit ABIN633092

Détail du produit anti-ATP8B2 anticorps

Antigène: ATP8B2 (ATPase, Aminophospholipid Transporter, Class I, Type 8B, Member 2 (ATP8B2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP8B2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP8 B2 antibody was raised against the N terminal of ATP8 2

Purification: Affinity purified

Immunogène: ATP8 B2 antibody was raised using the N terminal of ATP8 2 corresponding to a region with amino acids KTSKYNILTFLPVNLFEQFQEVANTYFLFLLILQLIPQISSLSWFTTIVP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP8B2 Blocking Peptide, catalog no. 33R-4690, is also available for use as a blocking control in assays to test for specificity of this ATP8B2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP8B2

Antigène: ATP8B2 (ATPase, Aminophospholipid Transporter, Class I, Type 8B, Member 2 (ATP8B2))

Autre désignation: ATP8B2 (ATP8B2 Produits)

Synonymes: anticorps Id, anticorps ATPID, anticorps fc09b04, anticorps wu:fc09b04, anticorps ATPase, class I, type 8B, member 2, anticorps ATPase phospholipid transporting 8B2, anticorps ATPase, aminophospholipid transporter, class I, type 8B, member 2, anticorps Atp8b2, anticorps ATP8B2, anticorps atp8b2

Sujet: The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified.

Poids moléculaire: 44 kDa (MW of target protein)