NUBP1 anticorps

N° du produit ABIN633112

Détail du produit anti-NUBP1 anticorps

Antigène: NUBP1 (Nucleotide Binding Protein 1 (NUBP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NUBP1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NUBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NUBP1 Blocking Peptide, catalog no. 33R-5911, is also available for use as a blocking control in assays to test for specificity of this NUBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NUBP1

Antigène: NUBP1 (Nucleotide Binding Protein 1 (NUBP1))

Autre désignation: NUBP1 (NUBP1 Produits)

Synonymes: anticorps DDBDRAFT_0169230, anticorps DDBDRAFT_0232424, anticorps DDB_0169230, anticorps DDB_0232424, anticorps NBP, anticorps NBP1, anticorps nbp, anticorps nbp1, anticorps nubp1, anticorps NBP 1, anticorps im:7144207, anticorps zgc:92138, anticorps nucleotide binding protein 1, anticorps nucleotide binding protein 1 (MinD homolog, E. coli), anticorps nucleotide binding protein 1 L homeolog, anticorps nucleotide binding protein 1 S homeolog, anticorps Nubp1, anticorps nubp1, anticorps NUBP1, anticorps nubp1.L, anticorps nubp1.S

Sujet: NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis