TACC3 anticorps (Middle Region)

N° du produit ABIN633120

Détail du produit anti-TACC3 anticorps

Antigène: TACC3 (Transforming, Acidic Coiled-Coil Containing Protein 3 (TACC3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TACC3 est non-conjugé

Application: Western Blotting (WB)

Specificité: TACC3 antibody was raised against the middle region of TACC3

Purification: Affinity purified

Immunogène: TACC3 antibody was raised using the middle region of TACC3 corresponding to a region with amino acids PGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGTSSFKES

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TACC3 Blocking Peptide, catalog no. 33R-7132, is also available for use as a blocking control in assays to test for specificity of this TACC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TACC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TACC3

Antigène: TACC3 (Transforming, Acidic Coiled-Coil Containing Protein 3 (TACC3))

Autre désignation: TACC3 (TACC3 Produits)

Synonymes: anticorps Aint, anticorps C86661, anticorps Eric1, anticorps ERIC-1, anticorps ERIC1, anticorps maskin, anticorps masking, anticorps xmaskin, anticorps transforming, acidic coiled-coil containing protein 3, anticorps transforming acidic coiled-coil containing protein 3, anticorps transforming acidic coiled-coil containing protein 3 S homeolog, anticorps Tacc3, anticorps TACC3, anticorps tacc3.S

Sujet: The function of this gene has not yet been determined, however, it is speculated that it may be involved in cell growth and differentiation. Expression of this gene is up-regulated in some cancer cell lines, and in embryonic day 15 in mice.

Poids moléculaire: 90 kDa (MW of target protein)

Pathways: Maintenance of Protein Location