FAM118A anticorps (Middle Region)
-
- Antigène Tous les produits FAM118A
- FAM118A (Family with Sequence Similarity 118, Member A (FAM118A))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FAM118A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FAM118 A antibody was raised against the middle region of FAM118
- Purification
- Affinity purified
- Immunogène
- FAM118 A antibody was raised using the middle region of FAM118 corresponding to a region with amino acids EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAM118A Blocking Peptide, catalog no. 33R-2802, is also available for use as a blocking control in assays to test for specificity of this FAM118A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FAM118A (Family with Sequence Similarity 118, Member A (FAM118A))
- Autre désignation
- FAM118A (FAM118A Produits)
- Synonymes
- anticorps C22orf8, anticorps 3110048E14Rik, anticorps C230014M12Rik, anticorps family with sequence similarity 118 member A, anticorps family with sequence similarity 118, member A, anticorps FAM118A, anticorps Fam118a
- Sujet
- The function of FAM118 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 40 kDa (MW of target protein)
-