ANKRD54 anticorps (Middle Region)

N° du produit ABIN633128

Détail du produit anti-ANKRD54 anticorps

Antigène: ANKRD54 (Ankyrin Repeat Domain 54 (ANKRD54))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANKRD54 est non-conjugé

Application: Western Blotting (WB)

Specificité: ANKRD54 antibody was raised against the middle region of ANKRD54

Purification: Affinity purified

Immunogène: ANKRD54 antibody was raised using the middle region of ANKRD54 corresponding to a region with amino acids EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGND

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANKRD54 Blocking Peptide, catalog no. 33R-2788, is also available for use as a blocking control in assays to test for specificity of this ANKRD54 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANKRD54

Antigène: ANKRD54 (Ankyrin Repeat Domain 54 (ANKRD54))

Autre désignation: ANKRD54 (ANKRD54 Produits)

Synonymes: anticorps LIAR, anticorps C730048E16Rik, anticorps EST1068184, anticorps EST475269, anticorps Liar, anticorps RGD1309552, anticorps wu:fi33d09, anticorps zgc:110569, anticorps zgc:92735, anticorps ankyrin repeat domain 54, anticorps ANKRD54, anticorps Ankrd54, anticorps ankrd54

Sujet: ANKRD54 is involved in protein complex binding and protein kinase regulator activity.

Poids moléculaire: 32 kDa (MW of target protein)