ALDH1A1 anticorps (Middle Region)

N° du produit ABIN633157

Détail du produit anti-ALDH1A1 anticorps

Antigène: ALDH1A1 (Aldehyde Dehydrogenase 1 Family, Member A1 (ALDH1A1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDH1A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ALDH1 A1 antibody was raised against the middle region of ALDH1 1

Purification: Affinity purified

Immunogène: ALDH1 A1 antibody was raised using the middle region of ALDH1 1 corresponding to a region with amino acids SVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALDH1A1 Blocking Peptide, catalog no. 33R-8907, is also available for use as a blocking control in assays to test for specificity of this ALDH1A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALDH1A1

Antigène: ALDH1A1 (Aldehyde Dehydrogenase 1 Family, Member A1 (ALDH1A1))

Autre désignation: ALDH1A1 (ALDH1A1 Produits)

Synonymes: anticorps ALDC, anticorps ALDH-E1, anticorps ALDH1, anticorps ALDH11, anticorps PUMB1, anticorps RALDH1, anticorps AL1A1, anticorps aldc, anticorps aldh-e1, anticorps aldh1, anticorps aldh11, anticorps pumb1, anticorps raldh1, anticorps GGADHR, anticorps ALDH1A1, anticorps ALDDH, anticorps Ahd2, anticorps Aldh1, anticorps Aldh2, anticorps Ahd-2, anticorps Aldh1a2, anticorps E1, anticorps Raldh1, anticorps Aldh1a1, anticorps ALHDII, anticorps RALDH 1, anticorps RalDH1, anticorps aldehyde dehydrogenase 1 family member A1, anticorps aldehyde dehydrogenase 1 family, member A1, anticorps aldehyde dehydrogenase 1 family member A1 L homeolog, anticorps aldehyde dehydrogenase family 1, subfamily A1, anticorps aldehyde dehydrogenase, anticorps retinal dehydrogenase 1, anticorps ALDH1A1, anticorps aldh1a1, anticorps Aldh1a1, anticorps aldh1a1.L, anticorps aldH1, anticorps LOC100732581, anticorps LOC101822890

Sujet: This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: Dopaminergic Neurogenesis