DOK6 anticorps (Middle Region)

N° du produit ABIN633168

Détail du produit anti-DOK6 anticorps

Antigène: DOK6 (Docking Protein 6 (DOK6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DOK6 est non-conjugé

Application: Western Blotting (WB)

Specificité: DOK6 antibody was raised against the middle region of DOK6

Purification: Affinity purified

Immunogène: DOK6 antibody was raised using the middle region of DOK6 corresponding to a region with amino acids IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DOK6 Blocking Peptide, catalog no. 33R-4227, is also available for use as a blocking control in assays to test for specificity of this DOK6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOK6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DOK6

Antigène: DOK6 (Docking Protein 6 (DOK6))

Autre désignation: DOK6 (DOK6 Produits)

Synonymes: anticorps DOK5L, anticorps HsT3226, anticorps Dok-6, anticorps RGD1564376, anticorps docking protein 6, anticorps DOK6, anticorps Dok6

Sujet: DOK6 is a member of the DOK family of intracellular adaptors that play a role in the RET signaling cascade.

Poids moléculaire: 38 kDa (MW of target protein)