KHDRBS3 anticorps (C-Term)

N° du produit ABIN633183

Détail du produit anti-KHDRBS3 anticorps

Antigène: KHDRBS3 (KH Domain Containing, RNA Binding, Signal Transduction Associated 3 (KHDRBS3))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KHDRBS3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: KHDRBS3 antibody was raised against the C terminal of KHDRBS3

Purification: Affinity purified

Immunogène: KHDRBS3 antibody was raised using the C terminal of KHDRBS3 corresponding to a region with amino acids EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KHDRBS3 Blocking Peptide, catalog no. 33R-2680, is also available for use as a blocking control in assays to test for specificity of this KHDRBS3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHDRBS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KHDRBS3

Antigène: KHDRBS3 (KH Domain Containing, RNA Binding, Signal Transduction Associated 3 (KHDRBS3))

Autre désignation: KHDRBS3 (KHDRBS3 Produits)

Synonymes: anticorps KHDRBS3, anticorps T-STAR, anticorps Etle, anticorps SALP, anticorps SLM-2, anticorps SLM2, anticorps TSTAR, anticorps etoile, anticorps Slm2, anticorps KH domain containing, RNA binding, signal transduction associated 3, anticorps KH RNA binding domain containing, signal transduction associated 3, anticorps KHDRBS3, anticorps Khdrbs3

Sujet: As a RNA-binding protein, KHDRBS3 plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. KHDRBS3 may play a role as a negative regulator of cell growth. It inhibits cell proliferation and involved in splice site selection of vascular endothelial growth factor. It induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. RNA-binding abilities are down-regulated by tyrosine kinase PTK6. It also involved in post-transcriptional regulation of HIV-1 gene expression.

Poids moléculaire: 38 kDa (MW of target protein)