SUPV3L1 anticorps

N° du produit ABIN633189

Détail du produit anti-SUPV3L1 anticorps

Antigène: SUPV3L1 (Suppressor of Var1, 3-Like 1 (SUPV3L1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SUPV3L1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SUPV3 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLFH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SUPV3L1 Blocking Peptide, catalog no. 33R-7571, is also available for use as a blocking control in assays to test for specificity of this SUPV3L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUPV0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SUPV3L1

Antigène: SUPV3L1 (Suppressor of Var1, 3-Like 1 (SUPV3L1))

Autre désignation: SUPV3L1 (SUPV3L1 Produits)

Synonymes: anticorps SUV3, anticorps 6330443E10Rik, anticorps wu:fc19b02, anticorps wu:fe37e06, anticorps Suv3 like RNA helicase, anticorps suppressor of var1, 3-like 1 (S. cerevisiae), anticorps SUV3-like helicase, anticorps SUPV3L1, anticorps Supv3l1, anticorps supv3l1

Sujet: SUPV3L1 is an ATPase and DNA/RNA helicase able to unwind DNA/DNA, DNA/RNA and RNA/RNA duplexes in the 5'-3' direction. SUPV3L1 may protect cells from apoptosis.

Poids moléculaire: 88 kDa (MW of target protein)