PGBD3 anticorps (N-Term)

N° du produit ABIN633195

Cet anticorps anti-PGBD3 Polyclonal Lapin (ABIN633195) détecte spécifiquement PGBD3 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour PGBD3 anticorps (N-Term) (ABIN633195)

Antigène: PGBD3 (PiggyBac Transposable Element Derived 3 (PGBD3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PGBD3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PGBD3 anticorps

Épitope: N-Term

Specificité: PGBD3 antibody was raised against the N terminal of PGBD3

Purification: Affinity purified

Immunogène: PGBD3 antibody was raised using the N terminal of PGBD3 corresponding to a region with amino acids AESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGBD3 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this PGBD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGBD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PGBD3

Antigène: PGBD3 (PiggyBac Transposable Element Derived 3 (PGBD3))

Autre désignation: PGBD3

Sujet: The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. Anti-PGBD3 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. Anti-PGBD3 overlaps with the ERCC6 gene on chromosome 10, and pseudogenes of this locus have been found on chromosomes 4, 5 and 12.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: Chromatin Binding