PGBD3 anticorps (N-Term)
-
- Antigène Voir toutes PGBD3 Anticorps
- PGBD3 (PiggyBac Transposable Element Derived 3 (PGBD3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PGBD3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PGBD3 antibody was raised against the N terminal of PGBD3
- Purification
- Affinity purified
- Immunogène
- PGBD3 antibody was raised using the N terminal of PGBD3 corresponding to a region with amino acids AESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLT
- Top Product
- Discover our top product PGBD3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PGBD3 Blocking Peptide, catalog no. 33R-1149, is also available for use as a blocking control in assays to test for specificity of this PGBD3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGBD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PGBD3 (PiggyBac Transposable Element Derived 3 (PGBD3))
- Autre désignation
- PGBD3 (PGBD3 Produits)
- Synonymes
- anticorps PGBD3, anticorps piggyBac transposable element derived 3, anticorps ERCC excision repair 6, chromatin remodeling factor, anticorps PGBD3, anticorps ERCC6
- Sujet
- The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. Anti-PGBD3 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. Anti-PGBD3 overlaps with the ERCC6 gene on chromosome 10, and pseudogenes of this locus have been found on chromosomes 4, 5 and 12.
- Poids moléculaire
- 67 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-