RNP anticorps

N° du produit ABIN633215

Détail du produit anti-RNP anticorps

Antigène: RNP (RNPC3) (RNA-Binding Region (RNP1, RRM) Containing 3 (RNPC3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNP est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RNPC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHAPLPPTSPQPPEEPPLPDEDEELSSEESEYESTDDEDRQRMNKLMELA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNPC3 Blocking Peptide, catalog no. 33R-5006, is also available for use as a blocking control in assays to test for specificity of this RNPC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNPC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNP

Antigène: RNP (RNPC3) (RNA-Binding Region (RNP1, RRM) Containing 3 (RNPC3))

Autre désignation: RNPC3 (RNPC3 Produits)

Synonymes: anticorps rnp, anticorps rbm40, anticorps zgc:136847, anticorps RBM40, anticorps RNP, anticorps SNRNP65, anticorps 2810441O16Rik, anticorps AI447568, anticorps C030014B17Rik, anticorps RNA binding region (RNP1, RRM) containing 3, anticorps RNA-binding region (RNP1, RRM) containing 3, anticorps RNPC3, anticorps rnpc3, anticorps Rnpc3

Sujet: RNPC3 is an RNA-binding protein involved in pre-mRNA splicing. RNPC3 participates in pre-mRNA U12-dependent splicing. RNPC3 binds to the 3'-stem-loop of m7G-capped U12 snRNA.

Poids moléculaire: 58 kDa (MW of target protein)