HELLS anticorps (Middle Region)

N° du produit ABIN633220

Détail du produit anti-HELLS anticorps

Antigène: HELLS (Helicase, Lymphoid-Specific (HELLS))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HELLS est non-conjugé

Application: Western Blotting (WB)

Specificité: HELLS antibody was raised against the middle region of HELLS

Purification: Affinity purified

Immunogène: HELLS antibody was raised using the middle region of HELLS corresponding to a region with amino acids QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HELLS Blocking Peptide, catalog no. 33R-7725, is also available for use as a blocking control in assays to test for specificity of this HELLS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HELLS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HELLS

Antigène: HELLS (Helicase, Lymphoid-Specific (HELLS))

Autre désignation: HELLS (HELLS Produits)

Synonymes: anticorps HELLS, anticorps cb65, anticorps pasg, anticorps sb:cb65, anticorps sb:cb749, anticorps im:6911667, anticorps AI323785, anticorps E130115I21Rik, anticorps LSH, anticorps Lysh, anticorps PASG, anticorps YFK8, anticorps Tbc1d12, anticorps SMARCA6, anticorps lsh, anticorps nbla10143, anticorps smarca6, anticorps helicase, lymphoid-specific, anticorps helicase, lymphoid specific, anticorps helicase, lymphoid specific L homeolog, anticorps HELLS, anticorps hells, anticorps Hells, anticorps hells.L

Sujet: HELLS is a lymphoid-specific helicase. Other helicases function in processes involving DNA strand separation, including replication, repair, recombination, and transcription. This protein is thought to be involved with cellular proliferation and may play a role in leukemogenesis.

Poids moléculaire: 92 kDa (MW of target protein)

Pathways: Chromatin Binding