HELLS anticorps (Middle Region)

N° du produit ABIN633220

Cet anticorps Lapin Polyclonal détecte spécifiquement HELLS dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour HELLS anticorps (Middle Region) (ABIN633220)

Antigène: HELLS (Helicase, Lymphoid-Specific (HELLS))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HELLS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HELLS anticorps

Épitope: Middle Region

Specificité: HELLS antibody was raised against the middle region of HELLS

Purification: Affinity purified

Immunogène: HELLS antibody was raised using the middle region of HELLS corresponding to a region with amino acids QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HELLS Blocking Peptide, (ABIN5613983), is also available for use as a blocking control in assays to test for specificity of this HELLS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HELLS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HELLS

Antigène: HELLS (Helicase, Lymphoid-Specific (HELLS))

Autre désignation: HELLS

Sujet: HELLS is a lymphoid-specific helicase. Other helicases function in processes involving DNA strand separation, including replication, repair, recombination, and transcription. This protein is thought to be involved with cellular proliferation and may play a role in leukemogenesis.

Poids moléculaire: 92 kDa (MW of target protein)

Pathways: Chromatin Binding