DAZL anticorps (C-Term)

N° du produit ABIN633244

Détail du produit anti-DAZL anticorps

Antigène: DAZL (Deleted in Azoospermia-Like (DAZL))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DAZL est non-conjugé

Application: Western Blotting (WB)

Specificité: DAZL antibody was raised against the C terminal of DAZL

Purification: Affinity purified

Immunogène: DAZL antibody was raised using the C terminal of DAZL corresponding to a region with amino acids EVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DAZL Blocking Peptide, catalog no. 33R-2778, is also available for use as a blocking control in assays to test for specificity of this DAZL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DAZL

Antigène: DAZL (Deleted in Azoospermia-Like (DAZL))

Autre désignation: DAZL (DAZL Produits)

Synonymes: anticorps DAZH, anticorps DAZL1, anticorps DAZLA, anticorps SPGYLA, anticorps DAZL, anticorps Xdazl, anticorps dazh, anticorps dazl1, anticorps dazla, anticorps spgyla, anticorps dazl-B, anticorps dazl-a, anticorps Daz-like, anticorps Dazh, anticorps Dazl1, anticorps Dazla, anticorps Tpx-2, anticorps Tpx2, anticorps deleted in azoospermia like, anticorps deleted in azoospermia-like, anticorps deleted in azoospermia-like L homeolog, anticorps DAZL, anticorps dazl, anticorps Dazl, anticorps dazl.L

Sujet: DAZ (Deleted in AZoospermia) is the potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females.

Poids moléculaire: 33 kDa (MW of target protein)