DDX58 anticorps

N° du produit ABIN633253

Détail du produit anti-DDX58 anticorps

Antigène: DDX58 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 58 (DDX58))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX58 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DDX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids EECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX58 Blocking Peptide, catalog no. 33R-2340, is also available for use as a blocking control in assays to test for specificity of this DDX58 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX58 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX58

Antigène: DDX58 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 58 (DDX58))

Autre désignation: DDX58 (DDX58 Produits)

Synonymes: anticorps RIG-I, anticorps RIGI, anticorps RLR-1, anticorps 6430573D20Rik, anticorps C330021E21, anticorps RHIV-1, anticorps RIG-1, anticorps DExD/H-box helicase 58, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 58, anticorps DEXD/H-box helicase 58, anticorps DDX58, anticorps Ddx58

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure.

Poids moléculaire: 106 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Hepatitis C