HNRNPUL1 anticorps (Middle Region)

N° du produit ABIN633257

Détail du produit anti-HNRNPUL1 anticorps

Antigène: HNRNPUL1 (Heterogeneous Nuclear Ribonucleoprotein U-Like 1 (HNRNPUL1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPUL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: HNRPUL1 antibody was raised against the middle region of Hnrpul1

Purification: Affinity purified

Immunogène: HNRPUL1 antibody was raised using the middle region of Hnrpul1 corresponding to a region with amino acids LPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPUL1 Blocking Peptide, catalog no. 33R-5262, is also available for use as a blocking control in assays to test for specificity of this HNRPUL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPUL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPUL1

Antigène: HNRNPUL1 (Heterogeneous Nuclear Ribonucleoprotein U-Like 1 (HNRNPUL1))

Autre désignation: HNRPUL1 (HNRNPUL1 Produits)

Synonymes: anticorps HNRPUL1, anticorps E1B-AP5, anticorps E1BAP5, anticorps E130317O14Rik, anticorps Hnrnpul, anticorps Hnrpul1, anticorps hnrpul1, anticorps wu:fb53d10, anticorps wu:fk45c03, anticorps zgc:85971, anticorps heterogeneous nuclear ribonucleoprotein U like 1, anticorps coiled-coil domain containing 97, anticorps heterogeneous nuclear ribonucleoprotein U-like 1, anticorps HNRNPUL1, anticorps CCDC97, anticorps Desac_1308, anticorps Hnrnpul1, anticorps hnrnpul1

Sujet: HNRPUL1 is a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport.

Poids moléculaire: 85 kDa (MW of target protein)