HNRNPUL1 anticorps (Middle Region)
-
- Antigène Voir toutes HNRNPUL1 Anticorps
- HNRNPUL1 (Heterogeneous Nuclear Ribonucleoprotein U-Like 1 (HNRNPUL1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HNRNPUL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HNRPUL1 antibody was raised against the middle region of Hnrpul1
- Purification
- Affinity purified
- Immunogène
- HNRPUL1 antibody was raised using the middle region of Hnrpul1 corresponding to a region with amino acids LPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGG
- Top Product
- Discover our top product HNRNPUL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HNRPUL1 Blocking Peptide, catalog no. 33R-5262, is also available for use as a blocking control in assays to test for specificity of this HNRPUL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPUL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HNRNPUL1 (Heterogeneous Nuclear Ribonucleoprotein U-Like 1 (HNRNPUL1))
- Autre désignation
- HNRPUL1 (HNRNPUL1 Produits)
- Synonymes
- anticorps HNRPUL1, anticorps E1B-AP5, anticorps E1BAP5, anticorps E130317O14Rik, anticorps Hnrnpul, anticorps Hnrpul1, anticorps hnrpul1, anticorps wu:fb53d10, anticorps wu:fk45c03, anticorps zgc:85971, anticorps heterogeneous nuclear ribonucleoprotein U like 1, anticorps coiled-coil domain containing 97, anticorps heterogeneous nuclear ribonucleoprotein U-like 1, anticorps HNRNPUL1, anticorps CCDC97, anticorps Desac_1308, anticorps Hnrnpul1, anticorps hnrnpul1
- Sujet
- HNRPUL1 is a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport.
- Poids moléculaire
- 85 kDa (MW of target protein)
-