UPF3A anticorps

N° du produit ABIN633304

Détail du produit anti-UPF3A anticorps

Antigène: UPF3A (UPF3 Regulator of Nonsense Transcripts Homolog A (UPF3A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UPF3A est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: UPF3 A antibody was raised using a synthetic peptide corresponding to a region with amino acids QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UPF3A Blocking Peptide, catalog no. 33R-7719, is also available for use as a blocking control in assays to test for specificity of this UPF3A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UPF3A

Antigène: UPF3A (UPF3 Regulator of Nonsense Transcripts Homolog A (UPF3A))

Autre désignation: UPF3A (UPF3A Produits)

Synonymes: anticorps 2600001C03Rik, anticorps 4930546M19Rik, anticorps RENT3A, anticorps UPF3, anticorps UPF3A, anticorps HUPF3A, anticorps si:dkey-21o13.6, anticorps UPF3 regulator of nonsense transcripts homolog A (yeast), anticorps UPF3A, regulator of nonsense mediated mRNA decay, anticorps Upf3a, anticorps UPF3A, anticorps upf3a

Sujet: UPF3A is part of a multiprotein post-splicing mRNP complex involved in both mRNA nuclear export and mRNA surveillance. UPF3A is involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.

Poids moléculaire: 55 kDa (MW of target protein)