DHX58 anticorps

N° du produit ABIN633307

Détail du produit anti-DHX58 anticorps

Antigène: DHX58 (DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHX58 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DHX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHX58 Blocking Peptide, catalog no. 33R-1634, is also available for use as a blocking control in assays to test for specificity of this DHX58 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX58 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHX58

Antigène: DHX58 (DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58))

Autre désignation: DHX58 (DHX58 Produits)

Synonymes: anticorps MGC82787, anticorps DHX58, anticorps lgp2, anticorps D11LGP2, anticorps D11lgp2e, anticorps LGP2, anticorps RLR-3, anticorps B430001I08Rik, anticorps D11Lgp2e, anticorps LPG2, anticorps Lgp2, anticorps RGD1310093, anticorps DEXH-box helicase 58 L homeolog, anticorps DExH-box helicase 58, anticorps probable ATP-dependent RNA helicase DHX58, anticorps DEXH (Asp-Glu-X-His) box polypeptide 58, anticorps DEXH-box helicase 58, anticorps dhx58.L, anticorps DHX58, anticorps dhx58, anticorps LOC100566102, anticorps Dhx58

Sujet: DHX58 is the negative regulator of host innate immune defense against viruses. The repressor domain of DHX58 interacts with DDX58 and negatively regulates DDX58-mediated signaling.

Poids moléculaire: 76 kDa (MW of target protein)