DDX59 anticorps

N° du produit ABIN633308

Détail du produit anti-DDX59 anticorps

Antigène: DDX59 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 59 (DDX59))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX59 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DDX59 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQKADSEPESPLNASYVYKEHPFILNLQEDQIENLKQQLGILVQGQEVTR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX59 Blocking Peptide, catalog no. 33R-7302, is also available for use as a blocking control in assays to test for specificity of this DDX59 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX59 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX59

Antigène: DDX59 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 59 (DDX59))

Autre désignation: DDX59 (DDX59 Produits)

Synonymes: anticorps si:dkey-39e8.2, anticorps ZNHIT5, anticorps 1210002B07Rik, anticorps 4833411G06Rik, anticorps DEAD-box helicase 59, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 59, anticorps DEAD-box helicase 59 L homeolog, anticorps DDX59, anticorps ddx59, anticorps ddx59.L, anticorps Ddx59

Sujet: The specific function of DDX59 is not yet known.

Poids moléculaire: 69 kDa (MW of target protein)