XPO1 anticorps
-
- Antigène Voir toutes XPO1 Anticorps
- XPO1 (Exportin 1 (XPO1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp XPO1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- XPO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH
- Top Product
- Discover our top product XPO1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
XPO1 Blocking Peptide, catalog no. 33R-6744, is also available for use as a blocking control in assays to test for specificity of this XPO1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPO1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- XPO1 (Exportin 1 (XPO1))
- Autre désignation
- XPO1 (XPO1 Produits)
- Synonymes
- anticorps CG13387, anticorps CRM1, anticorps Crm1, anticorps DCRM1, anticorps Dmel\\CG13387, anticorps Emb, anticorps XPO-1, anticorps XPO1, anticorps Xpo1, anticorps crm1, anticorps dCRM1, anticorps l(2)k16715, anticorps 18.m06600, anticorps DDBDRAFT_0183812, anticorps DDBDRAFT_0234066, anticorps DDB_0183812, anticorps DDB_0234066, anticorps exportin-1, anticorps LOC100220104, anticorps emb, anticorps exp1, anticorps Xpo, anticorps AA420417, anticorps Exp1, anticorps embargoed, anticorps exportin 1, anticorps putative exportin 1, anticorps chromosome region maintenance protein 1, anticorps exportin-1, anticorps exportin 1 (CRM1 homolog, yeast), anticorps exportin 1 S homeolog, anticorps emb, anticorps cgd3_3060, anticorps Tc00.1047053511725.150, anticorps Tb11.01.5940, anticorps BBOV_II007220, anticorps LMJF_32_1100, anticorps xpo1, anticorps Xpo1, anticorps XPO1, anticorps LOC100165622, anticorps LOC100633509, anticorps xpo1.S
- Sujet
- XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. XPO1 also regulates NFAT and AP-1.
- Poids moléculaire
- 123 kDa (MW of target protein)
- Pathways
- M Phase
-