AGFG1 anticorps (Middle Region)

N° du produit ABIN633314

L’anticorps anti-AGFG1 Polyclonal Lapin est utilisé pour la détection de AGFG1 dans des échantillons de Humain et Souris. Il a été validé pour WB.

Aperçu rapide pour AGFG1 anticorps (Middle Region) (ABIN633314)

Antigène: AGFG1 (HRB) (HIV-1 Rev Binding Protein (HRB))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGFG1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AGFG1 anticorps

Épitope: Middle Region

Specificité: HRB antibody was raised against the middle region of HRB

Purification: Affinity purified

Immunogène: HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HRB Blocking Peptide, (ABIN5614067), is also available for use as a blocking control in assays to test for specificity of this HRB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AGFG1

Antigène: AGFG1 (HRB) (HIV-1 Rev Binding Protein (HRB))

Autre désignation: HRB

Sujet: HRB is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. HRB binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs.

Poids moléculaire: 58 kDa (MW of target protein)