AGFG1 anticorps (Middle Region)

N° du produit ABIN633314

Détail du produit anti-AGFG1 anticorps

Antigène: AGFG1 (HRB) (HIV-1 Rev Binding Protein (HRB))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGFG1 est non-conjugé

Application: Western Blotting (WB)

Specificité: HRB antibody was raised against the middle region of HRB

Purification: Affinity purified

Immunogène: HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HRB Blocking Peptide, catalog no. 33R-8725, is also available for use as a blocking control in assays to test for specificity of this HRB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AGFG1

Antigène: AGFG1 (HRB) (HIV-1 Rev Binding Protein (HRB))

Autre désignation: HRB (HRB Produits)

Synonymes: anticorps HRB, anticorps RAB, anticorps RIP, anticorps AU045498, anticorps C130049H11Rik, anticorps C85612, anticorps D730048C23Rik, anticorps Hrb, anticorps Rip, anticorps hrb, anticorps agfg1, anticorps wu:fb14f05, anticorps wu:fi19d11, anticorps MGC83726, anticorps MGC97591, anticorps ArfGAP with FG repeats 1, anticorps ArfGAP with FG repeats 1a, anticorps ArfGAP with FG repeats 1 S homeolog, anticorps KRR1 small subunit processome component homolog, anticorps AGFG1, anticorps Agfg1, anticorps agfg1a, anticorps agfg1.S, anticorps agfg1, anticorps LOC5565923

Sujet: HRB is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. HRB binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs.

Poids moléculaire: 58 kDa (MW of target protein)