PSMA6 anticorps

N° du produit ABIN633332

Détail du produit anti-PSMA6 anticorps

Antigène: PSMA6 (Proteasome Subunit alpha 6 (PSMA6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMA6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PSMA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITEN

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSMA6 Blocking Peptide, catalog no. 33R-2815, is also available for use as a blocking control in assays to test for specificity of this PSMA6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSMA6

Antigène: PSMA6 (Proteasome Subunit alpha 6 (PSMA6))

Autre désignation: PSMA6 (PSMA6 Produits)

Synonymes: anticorps IOTA, anticorps PROS27, anticorps p27K, anticorps psma6, anticorps psma6b, anticorps zgc:91778, anticorps proteasome subunit alpha 6, anticorps proteasome (prosome, macropain) subunit, alpha type 6, anticorps proteasome subunit alpha 6a, anticorps proteasome subunit alpha 6 L homeolog, anticorps proteasome subunit alpha 6, like, anticorps PSMA6, anticorps Psma6, anticorps psma6a, anticorps psma6.L, anticorps psma6l

Sujet: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA6 is a member of the peptidase T1A family, which is a 20S core alpha subunit.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA