DDX1 anticorps
-
- Antigène Voir toutes DDX1 Anticorps
- DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1 (DDX1))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DDX1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DDX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGA
- Top Product
- Discover our top product DDX1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DDX1 Blocking Peptide, catalog no. 33R-4046, is also available for use as a blocking control in assays to test for specificity of this DDX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1 (DDX1))
- Autre désignation
- DDX1 (DDX1 Produits)
- Synonymes
- anticorps CG9054, anticorps DDX1, anticorps Dbp79E, anticorps DmDDX1, anticorps DmRH12, anticorps Dmel\\CG9054, anticorps anon-79E, anticorps DBP-RB, anticorps UKVH5d, anticorps si:ch211-214k9.2, anticorps si:dkey-161f12.1, anticorps AA409185, anticorps Dead-box-1, anticorps DEAD-box helicase 1, anticorps DEAD/H-box helicase 1 L homeolog, anticorps DEAD (Asp-Glu-Ala-Asp) box helicase 1, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 1, anticorps Ddx1, anticorps DDX1, anticorps ddx1.L, anticorps ddx1
- Sujet
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX1 is a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin.
- Poids moléculaire
- 82 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-