DDX50 anticorps

N° du produit ABIN633358

Cet anticorps Lapin Polyclonal détecte spécifiquement DDX50 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour DDX50 anticorps (ABIN633358)

Antigène: DDX50 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 50 (DDX50))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX50 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DDX50 anticorps

Purification: Affinity purified

Immunogène: DDX50 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETRENG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX50 Blocking Peptide, (ABIN5613169), is also available for use as a blocking control in assays to test for specificity of this DDX50 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX50

Antigène: DDX50 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 50 (DDX50))

Autre désignation: DDX50

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX50 is a DEAD box enzyme that may be involved in ribosomal RNA synthesis or processing.

Poids moléculaire: 82 kDa (MW of target protein)