DDX50 anticorps
-
- Antigène Voir toutes DDX50 Anticorps
- DDX50 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 50 (DDX50))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DDX50 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DDX50 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETRENG
- Top Product
- Discover our top product DDX50 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DDX50 Blocking Peptide, catalog no. 33R-7109, is also available for use as a blocking control in assays to test for specificity of this DDX50 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX50 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DDX50 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 50 (DDX50))
- Autre désignation
- DDX50 (DDX50 Produits)
- Synonymes
- anticorps GU2, anticorps GUB, anticorps RH-II/GuB, anticorps mcdrh, anticorps 4933429B04Rik, anticorps 8430408E17Rik, anticorps RH-II, anticorps DDX50, anticorps DDX21, anticorps DExD-box helicase 50, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 50, anticorps DExD-box helicase 21, anticorps DDX50, anticorps Ddx50, anticorps DDX21
- Sujet
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX50 is a DEAD box enzyme that may be involved in ribosomal RNA synthesis or processing.
- Poids moléculaire
- 82 kDa (MW of target protein)
-