RNMT anticorps
-
- Antigène Voir toutes RNMT Anticorps
- RNMT (RNA Guanine-7 Methyltransferase (RNMT))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNMT est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RNMT antibody was raised using a synthetic peptide corresponding to a region with amino acids ETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQ
- Top Product
- Discover our top product RNMT Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNMT Blocking Peptide, catalog no. 33R-2757, is also available for use as a blocking control in assays to test for specificity of this RNMT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNMT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNMT (RNA Guanine-7 Methyltransferase (RNMT))
- Autre désignation
- RNMT (RNMT Produits)
- Synonymes
- anticorps xCMT1, anticorps MET, anticorps RG7MT1, anticorps hCMT1c, anticorps 2610002P10Rik, anticorps AI848273, anticorps Rg7mt1, anticorps mKIAA0398, anticorps rnmt, anticorps im:6910566, anticorps wu:fi09c12, anticorps RNA (guanine-7-) methyltransferase L homeolog, anticorps RNA guanine-7 methyltransferase, anticorps RNA (guanine-7-) methyltransferase, anticorps rnmt.L, anticorps RNMT, anticorps Rnmt, anticorps rnmt
- Sujet
- RNMT belongs to the mRNA cap methyltransferase family. RNMT is a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. It binds RNA containing 5'-terminal GpppC.
- Poids moléculaire
- 55 kDa (MW of target protein)
-