RPS24 anticorps (Middle Region)

N° du produit ABIN633411

Détail du produit anti-RPS24 anticorps

Antigène: RPS24 (Ribosomal Protein S24 (RPS24))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS24 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPS24 antibody was raised against the middle region of RPS24

Purification: Affinity purified

Immunogène: RPS24 antibody was raised using the middle region of RPS24 corresponding to a region with amino acids GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS24 Blocking Peptide, catalog no. 33R-3257, is also available for use as a blocking control in assays to test for specificity of this RPS24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS24

Antigène: RPS24 (Ribosomal Protein S24 (RPS24))

Autre désignation: RPS24 (RPS24 Produits)

Synonymes: anticorps DBA3, anticorps S24, anticorps ribosomal protein S24 L homeolog, anticorps ribosomal protein S24, anticorps rps24.L, anticorps RPS24, anticorps Rps24

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 15 kDa (MW of target protein)