ERAL1 anticorps

N° du produit ABIN633436

Détail du produit anti-ERAL1 anticorps

Antigène: ERAL1 (Era G-Protein-Like 1 (ERAL1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERAL1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ERAL1 Blocking Peptide, catalog no. 33R-4675, is also available for use as a blocking control in assays to test for specificity of this ERAL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERAL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERAL1

Antigène: ERAL1 (Era G-Protein-Like 1 (ERAL1))

Autre désignation: ERAL1 (ERAL1 Produits)

Synonymes: anticorps ERAL1, anticorps 2610524P08Rik, anticorps 9130407C09Rik, anticorps AU019798, anticorps Era, anticorps M-ERA, anticorps MERA-S, anticorps MERA-W, anticorps GdERA, anticorps si:ch211-207c6.1, anticorps ERA, anticorps ERAL1A, anticorps H-ERA, anticorps HERA-A, anticorps HERA-B, anticorps eral1, anticorps Era like 12S mitochondrial rRNA chaperone 1, anticorps Era (G-protein)-like 1 (E. coli), anticorps Era-like 12S mitochondrial rRNA chaperone 1, anticorps Era-like 12S mitochondrial rRNA chaperone 1 L homeolog, anticorps GTP-binding protein era homolog, anticorps ERAL1, anticorps Eral1, anticorps eral1, anticorps eral1.L, anticorps eral

Sujet: The function of ERAL protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly