EIF2S2 anticorps (N-Term)

N° du produit ABIN633477

Détail du produit anti-EIF2S2 anticorps

Antigène: EIF2S2 (Eukaryotic Translation Initiation Factor 2, Subunit 2 Beta, 38kDa (EIF2S2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF2S2 est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF2 S2 antibody was raised against the N terminal of EIF2 2

Purification: Affinity purified

Immunogène: EIF2 S2 antibody was raised using the N terminal of EIF2 2 corresponding to a region with amino acids DEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF2S2 Blocking Peptide, catalog no. 33R-1911, is also available for use as a blocking control in assays to test for specificity of this EIF2S2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF2S2

Antigène: EIF2S2 (Eukaryotic Translation Initiation Factor 2, Subunit 2 Beta, 38kDa (EIF2S2))

Autre désignation: EIF2S2 (EIF2S2 Produits)

Synonymes: anticorps EIF2, anticorps EIF2B, anticorps EIF2beta, anticorps PPP1R67, anticorps eIF-2-beta, anticorps 2810026E11Rik, anticorps 38kDa, anticorps AA408636, anticorps AA571381, anticorps AA986487, anticorps AW822225, anticorps D2Ertd303e, anticorps zgc:77084, anticorps wu:fc26g03, anticorps wu:fu10f07, anticorps MGC130959, anticorps DDBDRAFT_0205105, anticorps DDBDRAFT_0234112, anticorps DDB_0205105, anticorps DDB_0234112, anticorps AO090005001412, anticorps eukaryotic translation initiation factor 2 subunit beta, anticorps eukaryotic translation initiation factor 2, subunit 2 (beta), anticorps eukaryotic translation initiation factor 2, subunit 2 beta, anticorps eukaryotic translation initiation factor 2 subunit beta L homeolog, anticorps eIF-3 beta, anticorps hypothetical protein, anticorps eukaryotic translation initiation factor 2 subunit 2, anticorps EIF2S2, anticorps Eif2s2, anticorps eif2s2, anticorps eif2s2.L, anticorps eIF2s2, anticorps TP02_0678, anticorps EDI_093670, anticorps AOR_1_2450174, anticorps MGYG_05853, anticorps PGTG_10708, anticorps LOC101111733

Sujet: Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation.

Poids moléculaire: 38 kDa (MW of target protein)