ERAL1 anticorps
-
- Antigène Voir toutes ERAL1 Anticorps
- ERAL1 (Era G-Protein-Like 1 (ERAL1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ERAL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKS
- Top Product
- Discover our top product ERAL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ERAL1 Blocking Peptide, catalog no. 33R-4708, is also available for use as a blocking control in assays to test for specificity of this ERAL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERAL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ERAL1 (Era G-Protein-Like 1 (ERAL1))
- Autre désignation
- ERAL1 (ERAL1 Produits)
- Synonymes
- anticorps ERAL1, anticorps 2610524P08Rik, anticorps 9130407C09Rik, anticorps AU019798, anticorps Era, anticorps M-ERA, anticorps MERA-S, anticorps MERA-W, anticorps GdERA, anticorps si:ch211-207c6.1, anticorps ERA, anticorps ERAL1A, anticorps H-ERA, anticorps HERA-A, anticorps HERA-B, anticorps eral1, anticorps Era like 12S mitochondrial rRNA chaperone 1, anticorps Era (G-protein)-like 1 (E. coli), anticorps Era-like 12S mitochondrial rRNA chaperone 1, anticorps Era-like 12S mitochondrial rRNA chaperone 1 L homeolog, anticorps GTP-binding protein era homolog, anticorps ERAL1, anticorps Eral1, anticorps eral1, anticorps eral1.L, anticorps eral
- Sujet
- ERAL1 belongs to the era/mnmE GTP-binding protein family.
- Poids moléculaire
- 48 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-