EIF4B anticorps (Middle Region)
-
- Antigène Voir toutes EIF4B Anticorps
- EIF4B (Eukaryotic Translation Initiation Factor 4B (EIF4B))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EIF4B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EIF4 B antibody was raised against the middle region of EIF4
- Purification
- Affinity purified
- Immunogène
- EIF4 B antibody was raised using the middle region of EIF4 corresponding to a region with amino acids QTGNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFS
- Top Product
- Discover our top product EIF4B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EIF4B Blocking Peptide, catalog no. 33R-7750, is also available for use as a blocking control in assays to test for specificity of this EIF4B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EIF4B (Eukaryotic Translation Initiation Factor 4B (EIF4B))
- Autre désignation
- EIF4B (EIF4B Produits)
- Synonymes
- anticorps EIF-4B, anticorps PRO1843, anticorps CG10837, anticorps Dm-eIF4B, anticorps Dmel\\CG10837, anticorps Eif4B, anticorps eIF-4B-L, anticorps eIF-4B-S, anticorps eIF-4b, anticorps eIF4B, anticorps eIF4B-L, anticorps eIF4B-S, anticorps eIf4b, anticorps 2310046H11Rik, anticorps AL024095, anticorps C85189, anticorps Eif4a2, anticorps eif4b, anticorps fb15c09, anticorps wu:fb15c09, anticorps zgc:101532, anticorps MGC89384, anticorps eukaryotic translation initiation factor 4B, anticorps eukaryotic initiation factor 4B, anticorps Eukaryotic initiation factor 4B, anticorps eukaryotic translation initiation factor 4Bb, anticorps eukaryotic translation initiation factor 4Ba, anticorps eukaryotic translation initiation factor 4B S homeolog, anticorps EIF4B, anticorps Eif4B, anticorps eIF-4B, anticorps Eif4b, anticorps eif4bb, anticorps eif4b, anticorps eif4ba, anticorps eif4b.S, anticorps LOC100284982, anticorps LOC100380867
- Sujet
- IF4B contains 1 RRM (RNA recognition motif) domain and is required for the binding of mRNA to ribosomes. Functions of EIF4B are in close association with EEF4-F and EIF4-A. It binds near the 5'-terminal cap of mRNA in presence of EIF-4F and ATP and promotes the ATPase activity and the ATP-dependent RNA unwinding activity of both EIF4-A and EIF4-F.
- Poids moléculaire
- 69 kDa (MW of target protein)
-