ANKRD42 anticorps (N-Term)

N° du produit ABIN633505

Détail du produit anti-ANKRD42 anticorps

Antigène: ANKRD42 (Ankyrin Repeat Domain 42 (ANKRD42))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANKRD42 est non-conjugé

Application: Western Blotting (WB)

Specificité: ANKRD42 antibody was raised against the N terminal of ANKRD42

Purification: Affinity purified

Immunogène: ANKRD42 antibody was raised using the N terminal of ANKRD42 corresponding to a region with amino acids MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANKRD42 Blocking Peptide, catalog no. 33R-6284, is also available for use as a blocking control in assays to test for specificity of this ANKRD42 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANKRD42

Antigène: ANKRD42 (Ankyrin Repeat Domain 42 (ANKRD42))

Autre désignation: ANKRD42 (ANKRD42 Produits)

Synonymes: anticorps SARP, anticorps 4931426M20, anticorps 4933417L02Rik, anticorps Ikbn, anticorps RGD1310789, anticorps ANKRD42, anticorps DKFZp469H1622, anticorps ankyrin repeat domain 42, anticorps ankyrin repeat domain 42 L homeolog, anticorps ANKRD42, anticorps Ankrd42, anticorps ankrd42.L

Sujet: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 43 kDa (MW of target protein)