ANKRD42 anticorps (N-Term)
-
- Antigène Tous les produits ANKRD42
- ANKRD42 (Ankyrin Repeat Domain 42 (ANKRD42))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ANKRD42 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ANKRD42 antibody was raised against the N terminal of ANKRD42
- Purification
- Affinity purified
- Immunogène
- ANKRD42 antibody was raised using the N terminal of ANKRD42 corresponding to a region with amino acids MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHW
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ANKRD42 Blocking Peptide, catalog no. 33R-6284, is also available for use as a blocking control in assays to test for specificity of this ANKRD42 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD42 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ANKRD42 (Ankyrin Repeat Domain 42 (ANKRD42))
- Autre désignation
- ANKRD42 (ANKRD42 Produits)
- Synonymes
- anticorps SARP, anticorps 4931426M20, anticorps 4933417L02Rik, anticorps Ikbn, anticorps RGD1310789, anticorps ANKRD42, anticorps DKFZp469H1622, anticorps ankyrin repeat domain 42, anticorps ankyrin repeat domain 42 L homeolog, anticorps ANKRD42, anticorps Ankrd42, anticorps ankrd42.L
- Sujet
- The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 43 kDa (MW of target protein)
-