PRPF8 anticorps

N° du produit ABIN633517

Détail du produit anti-PRPF8 anticorps

Antigène: PRPF8 (PRP8 Pre-mRNA Processing Factor 8 (PRPF8))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRPF8 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PRPF8 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRPF8 Blocking Peptide, catalog no. 33R-8515, is also available for use as a blocking control in assays to test for specificity of this PRPF8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRPF8

Antigène: PRPF8 (PRP8 Pre-mRNA Processing Factor 8 (PRPF8))

Autre désignation: PRPF8 (PRPF8 Produits)

Synonymes: anticorps id:ibd1257, anticorps ik:tdsubc_2a9, anticorps im:7141966, anticorps tdsubc_2a9, anticorps wu:fb37c02, anticorps wu:fb73e06, anticorps xx:tdsubc_2a9, anticorps zgc:56504, anticorps hprp8, anticorps prp-8, anticorps prp8, anticorps prpc8, anticorps rp13, anticorps HPRP8, anticorps PRP8, anticorps PRPC8, anticorps RP13, anticorps SNRNP220, anticorps AU019467, anticorps D11Bwg0410e, anticorps DBF3/PRP8, anticorps Prp8, anticorps Sfprp8l, anticorps pre-mRNA processing factor 8, anticorps pre-mRNA processing factor 8 S homeolog, anticorps Prpf8, anticorps prpf8, anticorps prpf8.S, anticorps PRPF8

Sujet: Pre-mRNA splicing occurs in 2 sequential transesterification steps. PRPF8 is a component of both U2- and U12-dependent spliceosomes, and found to be essential for the catalytic step II in pre-mRNA splicing process. It contains several WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp8 protein. The gene encoding PRPF8 is a candidate gene for autosomal dominant retinitis pigmentosa.Pre-mRNA splicing occurs in 2 sequential transesterification steps.

Poids moléculaire: 273 kDa (MW of target protein)