CTA-126B4.3 (N-Term) anticorps

N° du produit ABIN633524

Détail du produit

Antigène: CTA-126B4.3

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: CTA-126 B4.3 antibody was raised against the N terminal of CTA-126 4.3

Purification: Affinity purified

Immunogène: CTA-126 B4.3 antibody was raised using the N terminal of CTA-126 4.3 corresponding to a region with amino acids NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVP

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CTA-126B4.3 Blocking Peptide, catalog no. 33R-6923, is also available for use as a blocking control in assays to test for specificity of this CTA-126B4.3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTA-120 4.3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: CTA-126B4.3

Sujet: The function of CTA-126B4.3 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 32 kDa (MW of target protein)