FAM71D anticorps (Middle Region)

N° du produit ABIN633553

Détail du produit anti-FAM71D anticorps

Antigène: FAM71D (Family with Sequence Similarity 71, Member D (FAM71D))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM71D est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM71 D antibody was raised against the middle region of FAM71

Purification: Affinity purified

Immunogène: FAM71 D antibody was raised using the middle region of FAM71 corresponding to a region with amino acids VTVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM71D Blocking Peptide, catalog no. 33R-9860, is also available for use as a blocking control in assays to test for specificity of this FAM71D antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM71D

Antigène: FAM71D (Family with Sequence Similarity 71, Member D (FAM71D))

Autre désignation: FAM71D (FAM71D Produits)

Synonymes: anticorps GARI-L2, anticorps 4921509E07Rik, anticorps 4930516C23Rik, anticorps C14orf54, anticorps C10H14orf54, anticorps family with sequence similarity 71, member D, anticorps family with sequence similarity 71 member D, anticorps Fam71d, anticorps FAM71D

Sujet: The function of FAM71 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 46 kDa (MW of target protein)