C14orf21 anticorps (Middle Region)
-
- Antigène Tous les produits C14orf21
- C14orf21 (Chromosome 14 Open Reading Frame 21 (C14orf21))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C14orf21 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C14 ORF21 antibody was raised against the middle region of C14 rf21
- Purification
- Affinity purified
- Immunogène
- C14 ORF21 antibody was raised using the middle region of C14 rf21 corresponding to a region with amino acids GGTILESERARPRGSQSSEAQKTPAQECKPADFEVPETFLNRLQDLSSSF
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C14ORF21 Blocking Peptide, catalog no. 33R-3302, is also available for use as a blocking control in assays to test for specificity of this C14ORF21 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF21 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C14orf21 (Chromosome 14 Open Reading Frame 21 (C14orf21))
- Autre désignation
- C14ORF21 (C14orf21 Produits)
- Synonymes
- anticorps MGC69156, anticorps C14orf21, anticorps 2610027L16Rik, anticorps NOP9 nucleolar protein L homeolog, anticorps NOP9 nucleolar protein, anticorps similar to S. cerevisiae YJL010C, anticorps nop9.L, anticorps nop9, anticorps NOP9, anticorps Nop9, anticorps CaO19.11959
- Sujet
- The specific function of C14orf21 is not yet known.
- Poids moléculaire
- 69 kDa (MW of target protein)
-