C14orf21 anticorps (Middle Region)

N° du produit ABIN633556

Détail du produit anti-C14orf21 anticorps

Antigène: C14orf21 (Chromosome 14 Open Reading Frame 21 (C14orf21))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C14orf21 est non-conjugé

Application: Western Blotting (WB)

Specificité: C14 ORF21 antibody was raised against the middle region of C14 rf21

Purification: Affinity purified

Immunogène: C14 ORF21 antibody was raised using the middle region of C14 rf21 corresponding to a region with amino acids GGTILESERARPRGSQSSEAQKTPAQECKPADFEVPETFLNRLQDLSSSF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C14ORF21 Blocking Peptide, catalog no. 33R-3302, is also available for use as a blocking control in assays to test for specificity of this C14ORF21 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C14orf21

Antigène: C14orf21 (Chromosome 14 Open Reading Frame 21 (C14orf21))

Autre désignation: C14ORF21 (C14orf21 Produits)

Synonymes: anticorps MGC69156, anticorps C14orf21, anticorps 2610027L16Rik, anticorps NOP9 nucleolar protein L homeolog, anticorps NOP9 nucleolar protein, anticorps similar to S. cerevisiae YJL010C, anticorps nop9.L, anticorps nop9, anticorps NOP9, anticorps Nop9, anticorps CaO19.11959

Sujet: The specific function of C14orf21 is not yet known.

Poids moléculaire: 69 kDa (MW of target protein)