CSTF2T anticorps (C-Term)
-
- Antigène Voir toutes CSTF2T Anticorps
- CSTF2T (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa, tau Variant (CSTF2T))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CSTF2T est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CSTF2 T antibody was raised against the C terminal of CSTF2
- Purification
- Affinity purified
- Immunogène
- CSTF2 T antibody was raised using the C terminal of CSTF2 corresponding to a region with amino acids AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT
- Top Product
- Discover our top product CSTF2T Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CSTF2T Blocking Peptide, catalog no. 33R-1203, is also available for use as a blocking control in assays to test for specificity of this CSTF2T antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CSTF2T (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa, tau Variant (CSTF2T))
- Autre désignation
- CSTF2T (CSTF2T Produits)
- Synonymes
- anticorps 64kDa, anticorps C77975, anticorps tCstF-64, anticorps tauCstF-64, anticorps CstF-64T, anticorps cleavage stimulation factor, 3' pre-RNA subunit 2, tau, anticorps cleavage stimulation factor subunit 2 tau variant, anticorps cleavage stimulation factor subunit 2, tau variant, anticorps Cstf2t, anticorps CSTF2T
- Sujet
- CSTF2T may play a significant role in AAUAAA-independent mRNA polyadenylation in germ cells. It is directly involved in the binding to pre-mRNAs.
- Poids moléculaire
- 64 kDa (MW of target protein)
-