Ribonuclease H1 anticorps (Middle Region)

N° du produit ABIN633594

Détail du produit anti-Ribonuclease H1 anticorps

Antigène: Ribonuclease H1 (RNASEH1)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Ribonuclease H1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RNASEH1 antibody was raised against the middle region of RNASEH1

Purification: Affinity purified

Immunogène: RNASEH1 antibody was raised using the middle region of RNASEH1 corresponding to a region with amino acids EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNASEH1 Blocking Peptide, catalog no. 33R-2790, is also available for use as a blocking control in assays to test for specificity of this RNASEH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Ribonuclease H1

Antigène: Ribonuclease H1 (RNASEH1)

Autre désignation: RNASEH1 (RNASEH1 Produits)

Synonymes: anticorps H1RNA, anticorps RNH1, anticorps 74/9, anticorps CG8729, anticorps Dmel\\CG8729, anticorps RNase H1, anticorps RnH1, anticorps l(2)43F1-5, anticorps l(2)43Fa, anticorps l(2)k07409, anticorps l(2)k07624, anticorps rnhl, anticorps h1rna, anticorps rnh1, anticorps zgc:91971, anticorps RNASEH1P1, anticorps RNASEH1, anticorps rnaseh1, anticorps Afu1g10020, anticorps Tb07.26A24.40, anticorps ribonuclease H1, anticorps ribonuclease H1 S homeolog, anticorps ribonuclease H1 L homeolog, anticorps ribonuclease HI, anticorps Ribonuclease H1, anticorps RNASEH1, anticorps Rnaseh1, anticorps rnh1, anticorps rnaseh1.S, anticorps rnaseh1, anticorps rnaseh1.L, anticorps AFUA_1G10020, anticorps Tb927.7.4930, anticorps APH_RS00510

Sujet: RNASEH1 belongs to the RNase H family. It contains 1 RNase H domain. RNASEH1 is an endonuclease that specifically degrades the RNA of RNA-DNA hybrids.

Poids moléculaire: 32 kDa (MW of target protein)