SRGN anticorps (Middle Region)
-
- Antigène Voir toutes SRGN Anticorps
- SRGN (serglycin (SRGN))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SRGN est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Serglycin antibody was raised against the middle region of SRGN
- Purification
- Affinity purified
- Immunogène
- Serglycin antibody was raised using the middle region of SRGN corresponding to a region with amino acids RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY
- Top Product
- Discover our top product SRGN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Serglycin Blocking Peptide, catalog no. ABIN5616055, is also available for use as a blocking control in assays to test for specificity of this Serglycin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRGN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SRGN (serglycin (SRGN))
- Autre désignation
- Serglycin (SRGN Produits)
- Synonymes
- anticorps PPG, anticorps PRG, anticorps PRG1, anticorps Prg, anticorps Prg1, anticorps Sgc, anticorps Pgsg, anticorps serglycin, anticorps SRGN, anticorps Srgn
- Sujet
- SRGN is a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. SRGN was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis.
- Poids moléculaire
- 15 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location
-