SRGN anticorps (Middle Region)

N° du produit ABIN633597

Détail du produit anti-SRGN anticorps

Antigène: SRGN (serglycin (SRGN))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SRGN est non-conjugé

Application: Western Blotting (WB)

Specificité: Serglycin antibody was raised against the middle region of SRGN

Purification: Affinity purified

Immunogène: Serglycin antibody was raised using the middle region of SRGN corresponding to a region with amino acids RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Serglycin Blocking Peptide, catalog no. ABIN5616055, is also available for use as a blocking control in assays to test for specificity of this Serglycin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRGN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SRGN

Antigène: SRGN (serglycin (SRGN))

Autre désignation: Serglycin (SRGN Produits)

Synonymes: anticorps PPG, anticorps PRG, anticorps PRG1, anticorps Prg, anticorps Prg1, anticorps Sgc, anticorps Pgsg, anticorps serglycin, anticorps SRGN, anticorps Srgn

Sujet: SRGN is a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. SRGN was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis.

Poids moléculaire: 15 kDa (MW of target protein)

Pathways: Maintenance of Protein Location