SRPR anticorps
-
- Antigène Voir toutes SRPR Anticorps
- SRPR (Signal Recognition Particle Receptor (Docking Protein) (SRPR))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SRPR est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SRPR antibody was raised using a synthetic peptide corresponding to a region with amino acids EEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWELGGCANKEVLDYSTP
- Top Product
- Discover our top product SRPR Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SRPR Blocking Peptide, catalog no. 33R-2356, is also available for use as a blocking control in assays to test for specificity of this SRPR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRPR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SRPR (Signal Recognition Particle Receptor (Docking Protein) (SRPR))
- Autre désignation
- SRPR (SRPR Produits)
- Synonymes
- anticorps sralpha, anticorps srp-alpha, anticorps 1300011P19Rik, anticorps D11Mgi27, anticorps DP, anticorps Sralpha, anticorps SRP receptor alpha subunit, anticorps signal recognition particle receptor (docking protein), anticorps signal recognition particle receptor subunit alpha, anticorps signal recognition particle receptor, anticorps signal recognition particle receptor (Docking protein), anticorps signal recognition particle receptor ('docking protein'), anticorps srpra, anticorps ftsY, anticorps Tb11.01.1650, anticorps STER_1399, anticorps CMU_011790, anticorps EUBELI_01057, anticorps MGYG_00278, anticorps Tsp_06333, anticorps Srpr, anticorps Srpra, anticorps SRPRA
- Sujet
- SRPR belongs to the GTP-binding SRP family. It is in conjunction with SRP, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.
- Poids moléculaire
- 70 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-