TRPM3 anticorps (N-Term)
-
- Antigène Voir toutes TRPM3 Anticorps
- TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRPM3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TRPM3 antibody was raised against the N terminal of TRPM3
- Purification
- Affinity purified
- Immunogène
- TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids RPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISL
- Top Product
- Discover our top product TRPM3 Anticorps primaire
-
-
- Indications d'application
-
WB: 2 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TRPM3 Blocking Peptide, catalog no. 33R-8112, is also available for use as a blocking control in assays to test for specificity of this TRPM3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))
- Autre désignation
- TRPM3 (TRPM3 Produits)
- Synonymes
- anticorps GON-2, anticorps LTRPC3, anticorps MLSN2, anticorps 6330504P12Rik, anticorps 9330180E14, anticorps AU018608, anticorps B930001P07Rik, anticorps si:dkey-201c13.4, anticorps trpm6, anticorps transient receptor potential cation channel subfamily M member 3, anticorps transient receptor potential cation channel, subfamily M, member 3, anticorps TRPM3, anticorps Trpm3, anticorps trpm3
- Sujet
- TRPM3 belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Poids moléculaire
- 25 kDa (MW of target protein)
-