CACNB3 anticorps (N-Term)

N° du produit ABIN633634

Détail du produit anti-CACNB3 anticorps

Antigène: CACNB3 (Calcium Channel, Voltage-Dependent, beta 3 Subunit (CACNB3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CACNB3 est non-conjugé

Application: Western Blotting (WB)

Specificité: CACNB3 antibody was raised against the n terminal of CACNB3

Purification: Affinity purified

Immunogène: CACNB3 antibody was raised using the N terminal of CACNB3 corresponding to a region with amino acids MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CACNB3 Blocking Peptide, catalog no. 33R-6623, is also available for use as a blocking control in assays to test for specificity of this CACNB3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CACNB3

Antigène: CACNB3 (Calcium Channel, Voltage-Dependent, beta 3 Subunit (CACNB3))

Autre désignation: CACNB3 (CACNB3 Produits)

Synonymes: anticorps vgcc, anticorps xo28, anticorps xo32, anticorps o32-a, anticorps cacnlb3, anticorps VGCC, anticorps CACNB3, anticorps CAB3, anticorps CACNLB3, anticorps Beta3, anticorps Cchb3, anticorps CACH3B, anticorps cacnb3, anticorps Cacnb3, anticorps calcium channel, voltage-dependent, beta 3 subunit S homeolog, anticorps calcium channel, voltage-dependent, beta 3 subunit L homeolog, anticorps calcium voltage-gated channel auxiliary subunit beta 3, anticorps calcium channel, voltage-dependent, beta 3b, anticorps calcium channel, voltage-dependent, beta 3 subunit, anticorps calcium channel, voltage-dependent, beta 3a, anticorps cacnb3.S, anticorps cacnb3.L, anticorps CACNB3, anticorps cacnb3b, anticorps cacnb3, anticorps Cacnb3, anticorps cacnb3a

Sujet: The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction