CCT8L2 anticorps

N° du produit ABIN633635

Détail du produit anti-CCT8L2 anticorps

Antigène: CCT8L2 (Chaperonin Containing TCP1, Subunit 8 (Theta)-Like 2 (CCT8L2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCT8L2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CCT8 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGINVAVVLGEVDEETLTLADKYGIVVIQARSWMEIIYLSEVLDTPLLPR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCT8L2 Blocking Peptide, catalog no. 33R-1202, is also available for use as a blocking control in assays to test for specificity of this CCT8L2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCT8L2

Antigène: CCT8L2 (Chaperonin Containing TCP1, Subunit 8 (Theta)-Like 2 (CCT8L2))

Autre désignation: CCT8L2 (CCT8L2 Produits)

Synonymes: anticorps CESK1, anticorps chaperonin containing TCP1 subunit 8 like 2, anticorps CCT8L2

Sujet: CCT8L2 belongs to the TCP-1 chaperonin family. It possible molecular chaperone and assists the folding of proteins upon ATP hydrolysis.

Poids moléculaire: 59 kDa (MW of target protein)