KCTD4 anticorps (Middle Region)
-
- Antigène Voir toutes KCTD4 Anticorps
- KCTD4 (BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCTD4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCTD4 antibody was raised against the middle region of KCTD4
- Purification
- Affinity purified
- Immunogène
- KCTD4 antibody was raised using the middle region of KCTD4 corresponding to a region with amino acids EITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNI
- Top Product
- Discover our top product KCTD4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCTD4 Blocking Peptide, catalog no. 33R-2487, is also available for use as a blocking control in assays to test for specificity of this KCTD4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCTD4 (BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4))
- Autre désignation
- KCTD4 (KCTD4 Produits)
- Synonymes
- anticorps bA321C24.3, anticorps 2210017A09Rik, anticorps AU017169, anticorps wu:fk37b10, anticorps zgc:92463, anticorps potassium channel tetramerization domain containing 4, anticorps potassium channel tetramerisation domain containing 4, anticorps KCTD4, anticorps Kctd4, anticorps kctd4
- Sujet
- KCTD4 contains 1 BTB (POZ) domain. The exact function of KCTD4 remains unknown.
- Poids moléculaire
- 30 kDa (MW of target protein)
-