CACNB1 anticorps (Middle Region)

N° du produit ABIN633645

Détail du produit anti-CACNB1 anticorps

Antigène: CACNB1 (Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CACNB1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CACNB1 antibody was raised against the middle region of CACNB1

Purification: Affinity purified

Immunogène: CACNB1 antibody was raised using the middle region of CACNB1 corresponding to a region with amino acids KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CACNB1 Blocking Peptide, catalog no. 33R-4715, is also available for use as a blocking control in assays to test for specificity of this CACNB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CACNB1

Antigène: CACNB1 (Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1))

Autre désignation: CACNB1 (CACNB1 Produits)

Synonymes: anticorps CACNB1, anticorps zgc:91982, anticorps CAB1, anticorps CACNLB1, anticorps CCHLB1, anticorps Cchb1, anticorps Cchlb1, anticorps calcium voltage-gated channel auxiliary subunit beta 1, anticorps calcium channel, voltage-dependent, beta 1 subunit, anticorps calcium channel, voltage-dependent, beta 1 subunit S homeolog, anticorps CACNB1, anticorps cacnb1, anticorps Cacnb1, anticorps cacnb1.S

Sujet: CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.

Poids moléculaire: 58 kDa (MW of target protein)