CACNB1 anticorps (Middle Region)
-
- Antigène Voir toutes CACNB1 Anticorps
- CACNB1 (Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CACNB1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CACNB1 antibody was raised against the middle region of CACNB1
- Purification
- Affinity purified
- Immunogène
- CACNB1 antibody was raised using the middle region of CACNB1 corresponding to a region with amino acids KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE
- Top Product
- Discover our top product CACNB1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CACNB1 Blocking Peptide, catalog no. 33R-4715, is also available for use as a blocking control in assays to test for specificity of this CACNB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CACNB1 (Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1))
- Autre désignation
- CACNB1 (CACNB1 Produits)
- Synonymes
- anticorps CACNB1, anticorps zgc:91982, anticorps CAB1, anticorps CACNLB1, anticorps CCHLB1, anticorps Cchb1, anticorps Cchlb1, anticorps calcium voltage-gated channel auxiliary subunit beta 1, anticorps calcium channel, voltage-dependent, beta 1 subunit, anticorps calcium channel, voltage-dependent, beta 1 subunit S homeolog, anticorps CACNB1, anticorps cacnb1, anticorps Cacnb1, anticorps cacnb1.S
- Sujet
- CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.
- Poids moléculaire
- 58 kDa (MW of target protein)
-