Serotonin Receptor 3B anticorps

N° du produit ABIN633653

Détail du produit anti-Serotonin Receptor 3B anticorps

Antigène: Serotonin Receptor 3B (HTR3B)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Serotonin Receptor 3B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: Serotonin receptor 3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Serotonin receptor 3B Blocking Peptide , catalog no. 33R-7215, is also available for use as a blocking control in assays to test for specificity of this Serotonin receptor 3B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HTR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Serotonin Receptor 3B

Antigène: Serotonin Receptor 3B (HTR3B)

Autre désignation: Serotonin Receptor 3B (HTR3B Produits)

Synonymes: anticorps HTR3B, anticorps 5-HT3B, anticorps 5-hydroxytryptamine receptor 3B, anticorps 5-hydroxytryptamine (serotonin) receptor 3B, anticorps HTR3B, anticorps Htr3b

Sujet: The product of HTR3B belongs to the ligand-gated ion channel receptor superfamily. HTR3B encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Synaptic Membrane