CLIC5 anticorps (C-Term)
-
- Antigène Voir toutes CLIC5 Anticorps
- CLIC5 (Chloride Intracellular Channel 5 (CLIC5))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CLIC5 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- CLIC5 antibody was raised against the C terminal of CLIC5
- Purification
- Affinity purified
- Immunogène
- CLIC5 antibody was raised using the C terminal of CLIC5 corresponding to a region with amino acids YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
- Top Product
- Discover our top product CLIC5 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CLIC5 (Chloride Intracellular Channel 5 (CLIC5))
- Autre désignation
- CLIC5 (CLIC5 Produits)
- Synonymes
- anticorps MST130, anticorps MSTP130, anticorps 5730531E12Rik, anticorps B330005L24, anticorps Gm322, anticorps jbg, anticorps clic5, anticorps im:6907594, anticorps zgc:77538, anticorps CLIC5, anticorps zgc:101827, anticorps chloride intracellular channel 5, anticorps chloride intracellular channel 5b, anticorps chloride intracellular channel 5a, anticorps chloride intracellular channel 5 L homeolog, anticorps CLIC5, anticorps Clic5, anticorps clic5b, anticorps clic5a, anticorps clic5.L
- Sujet
- Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-