KCNRG anticorps (N-Term)
-
- Antigène Voir toutes KCNRG Anticorps
- KCNRG (Potassium Channel Regulator (KCNRG))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNRG est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNRG antibody was raised against the N terminal of KCNRG
- Purification
- Affinity purified
- Immunogène
- KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIF
- Top Product
- Discover our top product KCNRG Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNRG Blocking Peptide, catalog no. 33R-6505, is also available for use as a blocking control in assays to test for specificity of this KCNRG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNRG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNRG (Potassium Channel Regulator (KCNRG))
- Autre désignation
- KCNRG (KCNRG Produits)
- Synonymes
- anticorps DLTET, anticorps Clld4, anticorps E030012H22Rik, anticorps Gm745, anticorps putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase, anticorps potassium channel regulator, anticorps LOC5569660, anticorps KCNRG, anticorps Kcnrg
- Sujet
- KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels and inhibits their function.
- Poids moléculaire
- 31 kDa (MW of target protein)
-