NUDT9 anticorps
-
- Antigène Voir toutes NUDT9 Anticorps
- NUDT9 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 9 (NUDT9))
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NUDT9 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogène
- NUDT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHA
- Top Product
- Discover our top product NUDT9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NUDT9 Blocking Peptide, catalog no. 33R-4873, is also available for use as a blocking control in assays to test for specificity of this NUDT9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NUDT9 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 9 (NUDT9))
- Autre désignation
- NUDT9 (NUDT9 Produits)
- Synonymes
- anticorps sb:cb392, anticorps wu:fj16b09, anticorps wu:fu33g07, anticorps zgc:63924, anticorps LOC100230616, anticorps NUDT10, anticorps 1190002C07Rik, anticorps AI462474, anticorps nudix (nucleoside diphosphate linked moiety X)-type motif 9, anticorps nudix hydrolase 9, anticorps nudt9, anticorps NUDT9, anticorps Nudt9
- Sujet
- Human ADP-ribose pyrophosphatase NUDT9 belongs to a superfamily of Nudix hydrolases that catabolize potentially toxic compounds in the cell. NUDT9 alpha protein is targeted highly specifically to mitochondria, whereas the predicted protein of the NUDT9 beta transcript, which is missing this sequence, exhibits no clear subcellular localization. Investigation of the physical and enzymatic properties of NUDT9 indicates that it is functional as a monomer, optimally active at near neutral pH, and that it requires divalent metal ions and an intact Nudix motif for enzymatic activity.
- Poids moléculaire
- 33 kDa (MW of target protein)
-