MLC1 anticorps (Middle Region)

N° du produit ABIN633710

Détail du produit anti-MLC1 anticorps

Antigène: MLC1

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MLC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MLC1 antibody was raised against the middle region of MLC1

Purification: Affinity purified

Immunogène: MLC1 antibody was raised using the middle region of MLC1 corresponding to a region with amino acids SDSANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MLC1 Blocking Peptide, catalog no. 33R-8370, is also available for use as a blocking control in assays to test for specificity of this MLC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MLC1

Antigène: MLC1

Abstract: MLC1 Produits

Synonymes: anticorps LVM, anticorps MLC, anticorps VL, anticorps AW048630, anticorps BB074274, anticorps Kiaa0027-hp, anticorps WKL1, anticorps mKIAA0027, anticorps si:ch211-192n14.1, anticorps megalencephalic leukoencephalopathy with subcortical cysts 1, anticorps megalencephalic leukoencephalopathy with subcortical cysts 1 homolog (human), anticorps MLC1, anticorps Mlc1, anticorps mlc1

Sujet: MLC1 may be a transporter. It may act as a non-selective neuronal cation channel.

Poids moléculaire: 41 kDa (MW of target protein)