MLC1 anticorps (Middle Region)
-
- Antigène Tous les produits MLC1
- MLC1
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MLC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MLC1 antibody was raised against the middle region of MLC1
- Purification
- Affinity purified
- Immunogène
- MLC1 antibody was raised using the middle region of MLC1 corresponding to a region with amino acids SDSANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHL
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MLC1 Blocking Peptide, catalog no. 33R-8370, is also available for use as a blocking control in assays to test for specificity of this MLC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MLC1
- Abstract
- MLC1 Produits
- Synonymes
- anticorps LVM, anticorps MLC, anticorps VL, anticorps AW048630, anticorps BB074274, anticorps Kiaa0027-hp, anticorps WKL1, anticorps mKIAA0027, anticorps si:ch211-192n14.1, anticorps megalencephalic leukoencephalopathy with subcortical cysts 1, anticorps megalencephalic leukoencephalopathy with subcortical cysts 1 homolog (human), anticorps MLC1, anticorps Mlc1, anticorps mlc1
- Sujet
- MLC1 may be a transporter. It may act as a non-selective neuronal cation channel.
- Poids moléculaire
- 41 kDa (MW of target protein)
-